Required for insertion of 4Fe-4S clusters for at least IspG.

Belongs to the HesB/IscA family.

116 amino acids

MSVESFTPTAIQFSQGAASKVKSLVDEEGNPRLKLRVFVTGGGCSGFQYGFTFDEDVADDDTVIEREGVSLVVDPMSYQYLAGAEVDYQEGLEGSRFVIKNPNATTTCGCGQSFSI

12.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make erpA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here