Probably involved in the insertion of Fe-S clusters into apoproteins in vivo including IspG and/or IspH. Essential for growth under aerobic conditions and for anaerobic respiration but not for fermentation. In vitro it binds Fe-S clusters and transfers them to apo-IspG, which is involved in quinone biosynthesis among many other cell components. Experiments indicate that it is probably also involved in the insertion of other Fe-S clusters than IspG/IspH.

Belongs to the HesB/IscA family.

114 amino acids

MSDDVALPLEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI

12.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make erpA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here