Mitochondrial DNA endonuclease involved in intron homing. Cleaves only one strand of intronless DNA sequence at the site which coincides with the I-SceII cleavage recognition site.

Belongs to the LAGLIDADG endonuclease family.

309 amino acids

MKKEEKKENKKREQNQISSKKWNEWLAGLIDGAGKFTLSKSGYANLDILLELRDEKCHIELKQRFGGEIKRKETTLIRYRVHRLYGIRQLIACVNGHIRHPLRKIEFKEICMHYNVEYKEPETLTFANGWLSGYFDAVGLIEFSTEQDQLYLAFRHKKNTMLNELEIQKCLGVNLTCEQNGCSCESVTLYKINKKTVLSLYKYFKKYRLRSSIKTTQILLIPQFYEIQNETKEINDMQVKQKLWKQFFKKWYVDEMVKYESVKLANYYKSKTSPEKRVKKLIKLKFHRNERIRKRAERLELQKEKEKKA

37.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ai2a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here