Protein expression services for Ift52 | Intraflagellar transport protein 52 homolog
Description
Involved in ciliogenesis as part of a complex involved in intraflagellar transport (IFT), the bi-directional movement of particles required for the assembly, maintenance and functioning of primary cilia (PubMed:19253336). Required for the anterograde transport of IFT88 (By similarity).
Species
Mus musculus
Length
426 amino acids
Sequence
MEKELRSTILFNAYKKEVFTTNTGYKSLQKRLRSNWKIQSLKDEITSEKLIGVKLWITAGPREKFTAAEFEVLKKYLDSGGDILVMLGEGGESRFDTNINFLLEEYGIMVNNDAVVRNVYYKYFHPKEALVSDGVLNREISRAAGKAVPGVIDEENSGNNAQALTFVYPFGATLSVMKPAVAVLSTGSVCFPLNRPILAFYHSKNQGFGKLAVLGSCHMFSDQYLDKEENSKIMDVVFQWLTTGDIHLNQIDAEDPEISDYTMVPDTATLSEQLRVCLQEGDENPRDFTTLFDLSIYQLDTTCLPKVIKAHEELNVKHEPLQLVQPQFEMPLPALQPAVFPPSFRELPPPPLELFDLDETFSSEKARLAQITNKCTDEDLEFYVRKCGDILGVTSKLPKDQQDAKHILEHIFFQVVEFKKLNQEAH
Mass
48.2 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Ift52 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here