Involved in a phospholipid transport pathway that maintains lipid asymmetry in the outer membrane by retrograde trafficking of phospholipids from the outer membrane to the inner membrane. May transfer phospholipid across the periplasmic space and deliver it to the MlaFEDB complex at the inner membrane.

Belongs to the MlaC/ttg2D family.

214 amino acids

MNLIQLKKWFTILTFVLTAFLVTRTAIAETSPYVLMQQAADKLFSDIQANQSKIKQDPNYLRTIVRNDLLPYVNLEYAGSKVLGSYYKSTSAEQREKFFKTFGELIEQKYAQALTNYSNQKIQIESEKELGDNNFINIRVNIIQANGVAPILLYFKWRKGNKSGEWKVYDMVGAGVSMLEDTIKNWVGILNKQGIDTLITKMQQSASQPIIFNQ

24.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mlaC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here