About Products Protein Database Contact

Protein expression services for mlaC | Intermembrane phospholipid transport system binding protein MlaC

Description
Involved in a phospholipid transport pathway that maintains lipid asymmetry in the outer membrane by retrograde trafficking of phospholipids from the outer membrane to the inner membrane. May transfer phospholipid across the periplasmic space and deliver it to the MlaFEDB complex at the inner membrane.
Family
Belongs to the MlaC/ttg2D family.
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Length
214 amino acids
Sequence
MNLIQLKKWFTILTFVLTAFLVTRTAIAETSPYVLMQQAADKLFSDIQANQSKIKQDPNYLRTIVRNDLLPYVNLEYAGSKVLGSYYKSTSAEQREKFFKTFGELIEQKYAQALTNYSNQKIQIESEKELGDNNFINIRVNIIQANGVAPILLYFKWRKGNKSGEWKVYDMVGAGVSMLEDTIKNWVGILNKQGIDTLITKMQQSASQPIIFNQ
Mass
24.5 kDa
Simulated SDS-PAGE
Western blot of mlaC recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make mlaC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here