Cytokine which binds to interferon gamma receptor 1 (ifngr1) (PubMed:19577303, PubMed:20507977). Has activating effects on primary macrophages (PubMed:20507977). Induces nitric oxide production and phagocytic responses in macrophages (PubMed:20507977). Primes monocytes for production of reactive oxygen intermediates (ROI), although the effect is short-lived (PubMed:20507977). Also has inhibitory effects on monocyte priming by ifng1 (interferon gamma 1) and tnfb (TNF-alpha 2) (PubMed:20507977). Stimulates phosphorylation of the JAK/STAT signal transducer stat1, but fails to induce stat1 nuclear localization (PubMed:20507977). Promotes increased expression of a number of genes important for macrophage activity, including the interferon regulatory factors irf2 and irf9 (PubMed:20507977).

Belongs to the type II (or gamma) interferon family.

166 amino acids

MYCRLNMVYLICALLLIVSLQGTVGARLPQSQKDKEQMLKNVREKIESLQKHYHTTGTEWFGKSVLSSHLHQLNSKASCTCQSLLLDSMLNITETIFQDMRGKAENEETKTSLRDVMTEVKMLRHKYSEEQKVWRELQDIHSVEVNNGKIQKGALNSFLILYDLAY

19.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ifng1r using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here