Involved in antiviral response. Associates with IFNAR1 to form the type I interferon receptor. In the presence of intracellular IFNAR2 (iIFNAR2) and IFNA1 (iIFN1b isoform), may mediate STAT1 and STAT2 phosphorylation and induction of EIF2AK2, MX1 and RSAD2.

Belongs to the type II cytokine receptor family.

268 amino acids

MGPWTLLLLHLPLVVSMLPAPTNVSIVSFNLEHTLTWLPGPETPDNTHFTVQSLRKNSWQLVKGCARLKTRQSCDLTNTFKDPFYHYKARVQAITTTQKSNRSLSMLFYPLTDTLLGPPVVSVSGCGNCPLLQVTPPTSRGLQRSLSPTQLYYRQFTCKVRRTRDGSQFSMWVTSTEKTVIGYLEPGAEYCVTVTPSTSFNPHSVPSEPHCAFTSPTAANTVPVVLSVLCAFSLLVVLLCGIVVYSGRLLCMHKPLPKTLSSVPLCGG

29.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ifnar2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here