Description
Has antiviral and antiproliferative activities (PubMed:15254193). Produced by macrophages and stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase (By similarity). During viral infection, mediates antiviral effect, either directly by inducing interferon-stimulated genes, either indirectly through stimulation of natural killer cells enabling them to control viral replication (PubMed:22912583).
Family
Belongs to the alpha/beta interferon family.
Sequence
MARLCAFLMILIVMSYWSTCSLGCDLPHTYNLRNKRALKVLAQMRRLTPLSCLKDRKDFGFPLEKVDAQQIQKAQSIPVLRDLTQQILNLFASKDSSAAWNATLLDSFCNDLHQQLNDLQGCLMQQVGVQESPLTQEDSLLAVRIYFHRITVFLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEKA
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service