Has antiviral and antiproliferative activities (PubMed:15254193). Produced by macrophages and stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase (By similarity). During viral infection, mediates antiviral effect, either directly by inducing interferon-stimulated genes, either indirectly through stimulation of natural killer cells enabling them to control viral replication (PubMed:22912583).

Belongs to the alpha/beta interferon family.

190 amino acids

MARLCAFLMILIVMSYWSTCSLGCDLPHTYNLRNKRALKVLAQMRRLTPLSCLKDRKDFGFPLEKVDAQQIQKAQSIPVLRDLTQQILNLFASKDSSAAWNATLLDSFCNDLHQQLNDLQGCLMQQVGVQESPLTQEDSLLAVRIYFHRITVFLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEKA

21.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Ifna11 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here