Component of the Integrator complex, a complex involved in the transcription of small nuclear RNAs (snRNA) and their 3'-box-dependent processing (PubMed:21078872, PubMed:23097424). May be involved in the 3'-end processing of the spliceosomal snRNAs U1, U2, U4 and U5 but is probably not essential for 3'-end processing of the snRNA U7 (PubMed:21078872, PubMed:23097424).

Belongs to the Integrator subunit 10 family.

631 amino acids

MPSQEENELYMVKEAQRLRKSDPCAAMAWIITAKTLYPNAFNLQYEAYLLERDAQNYEEAAKCFSAIATNFQNQHTELWQEINSLTNALRNENETTPEHEFYVKMYKHLTPEVQHNIFMHTINHSADNLERIYIYILMFNKFPKSAITQAPRLLEMLAEGMKTEPDLYQRILVEEVLPMIQNKPPELSPNLACRLYTSSLEFYLRQIMDESDTADAWKNIFKVLMICGQMMGWEPFLPFSKHVNQNVYWEKLVDILSGSPAGSSQVLFYATTLFIYSLHGYIRNCKLRIEDADVTHVLVEGFMEWSPEGDGSEVPSMEPPKFSLTTAISPELSKAFLHAAQCWQLLNTDQFQRDFSQLMLALPLAPWISRFLFDLAIYFGHRDEANKLMADMTTQSSLVQSLQILSLNLMQGSMTLQGFQCILKILSELPTTQGQLLENMSLKGHRHMVFLPLTRSALVQYCVGAIISRLSRKVFEPNVPDRLLGDILVLQQLNLLNDVLLTQQIFNLIKQRKSFNLRTLSTYIINIDLLEELSHIWNSQQEDNFELTSSPNSSGTPTATTVAGGSQSRRIGTRGADKGARDEFRAITRQQIARCNENVITLLANFINQEHLMLAQHIFGISQPVETIVIK

72.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make IntS10 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here