IGF-binding proteins prolong the half-life of IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs in cell culture. They alter the interaction of IGFs with their cell surface receptors (By similarity).

270 amino acids

MPRLPLLLLLLPSLARGLGLRDAGRRHPECSPCQQDRCPAPSPCPAPWISARDECGCCARCLGAEGASCGGPVGSRCGPGLVCASRASGTAPEGTGLCVCAQRGAVCGSDGRSYSSICALRLRARHAPRAHHGHLHKARDGPCEFAPVVLMPPRDIHNVTGTQVFLSCEVKAVPTPVITWKKVKHSPEGTEGLEELPGDHVNIAVQVRGGPSDHETTSWILINPLRKEDEGVYHCHAANAIGEAQSHGTVTVLDLNRYKSLYSSVPGDLL

28.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Igfbpl1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here