The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. Promotes anterior neural development.

Belongs to the insulin family.

127 amino acids

MPVTAMCLQDSKKLKKAKLTRKKVTPFPFSRMVLCLSLVFTLYVEATNARCLRPRSKELLCGSELVDILQFICGPTGFYVSKGASFRNRNRPGIVEECCFCGCSVAILESYCAAPVTNFTGREEQKS

14.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make igf3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here