Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth.

Belongs to the IMPDH/GMPR family.

536 amino acids

MAVNGNNTFLDHTSAMEVLKEYERRDGLDIRDLMDSKLQGGLTYNDFLLLPGYIGFPASAVTLDSPITKRITLKTPLVSSPMDTVTEHEMAIHMALQGGVGVIHHNCSPDEQADMVRKVKRYENGFILDPVVITRDTTVGEAKALKEKWGFGGFPVTESGNLGSKLVGIVTNRDIQFETDLDKPVSEVMVTDLITATAGVNLLEANKILAESKKGKLPIIDKEGNLVSMISRSDLTKNLHFPLASKTKDSKQLICAAAIGTRPEDKDRLAKLVDAGLDIVILDSSQGNSMYQIEMIKWIKKEFPDLDVIGGNVVTREQAAALIAAGVDGLRIGMGSGSACITQEVMAVGRPQATAVYNVSSFAARFGVPCIADGGIQNVGHIVKGLALGASTVMMGGLLAGTTESPGTSFVSREGKLVKAYRGMGSIDAMQDKKAGGGGKDAQKSNAGTARYFSEGDSILVAQGVSGAVAHRGSINKFVPYLAAGLKHSLQDCGMTSLQELHECVENGTVRFEIRTASAQLEGGVNMESYEKKLYA

57.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make NCU03117 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here