Description
Pyrophosphatase that hydrolyzes non-canonical purine nucleotides such as inosine triphosphate (ITP), deoxyinosine triphosphate (dITP) or xanthosine 5'-triphosphate (XTP) to their respective monophosphate derivatives. The enzyme does not distinguish between the deoxy- and ribose forms. Probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions.
Family
Belongs to the HAM1 NTPase family.
Sequence
MSAAARVLPKAVTFVTGNAKKLEEVRAILGSSIPFQSLKLDLPELQGEPEDISKEKARMAASQVNGPVLVEDTCLCFNALKGLPGPYIKWFLEKIGHEGLNNLLKAYEDKSAFAMCIFSLALGPGEEPITFVGKTAGKIVPARGPNDFGWDPVFQPDGFEQTYAEMPKSVKNEISHRGKALALVKEHFASASYTVQSDNSA
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service