Pyrophosphatase that hydrolyzes non-canonical purine nucleotides such as inosine triphosphate (ITP), deoxyinosine triphosphate (dITP) or xanthosine 5'-triphosphate (XTP) to their respective monophosphate derivatives. The enzyme does not distinguish between the deoxy- and ribose forms. Probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions.

Belongs to the HAM1 NTPase family.

184 amino acids

MPQTLFFVTSNASKLAEVSAILAASGISVQSMALDLPELQGSIEDISKDKAKRAAEAIGGPVLVEDTCLCFNALKGLPGPYIKWFMKDLGHEGLVNMLAAYEDKSAQAVCTFAHCEGPGKEPVLFQGRTDGKIVPPRGPAKFGWDPIFEYEGQTYAEMDKAAKNLISHRFKALEMLKEWMEAHP

20.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GSTUM_00005907001 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here