About Products Protein Database Contact

Protein expression services for ipp | Inorganic pyrophosphatase

Description
Catalyzes the hydrolysis of inorganic pyrophosphate (PPi) forming two phosphate ions (By similarity) (PubMed:26546423). The hydrolysis of PPi by inorganic pyrophosphatase releases a considerable amount of energy that can drive unfavorable biochemical transformations to completion (Probable). Is not active on nucleoside triphosphates (ATP, TTP, GTP, or CTP) or nucleoside diphosphate (ADP) (PubMed:26546423).
Family
Belongs to the PPase family.
Species
Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Length
177 amino acids
Sequence
MVNLWEDMETGPNAPDEIYAVVECLKGERNKYEYDKDIPGVVLDRVLHSNVHYPSDYGFIPQTYYDDEDPFDVLVLVEDQTFPGCVIEARPVALMKMDDDGEQDDKVIAVPVEDPRYDHIEDLDDIPQQTLDEIDEFFATYKNLEAGKEVETLGWEDKQAAKDAIEHAMDLYEENFA
Mass
20.4 kDa
Simulated SDS-PAGE
Western blot of ipp recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ipp using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here