Component of the kinetochore, a multiprotein complex that assembles on centromeric DNA and attaches chromosomes to spindle microtubules, mediating chromosome segregation and sister chromatid segregation during meiosis and mitosis. Component of the inner kinetochore constitutive centromere-associated network (CCAN), which serves as a structural platform for outer kinetochore assembly.

Belongs to the CENP-K/MCM22 family.

277 amino acids

MNSENASLFRNILNDTENLVQPLTQDESRLALFESLVQSDQLLVEKIEKWEKKVSKFTENSKSEKRKLQLELFQEIIDLKKCIAFKPIIGKNAIDNNISDLKKNLHSNKKLEAVLKEELHQIKKFSSDLQSLKSSMGERQKQQAAMSRRGKKSIIHSAIIQEKERYEKESQELFTFLDGFLDEHAPSLLEGAQASIDKNRPGKNQPSLNFENISKKDLTEEFKQVIENLMNNSIIPGSPYIEVKNERIVSFLVLASLCTVDPQDPSKVKLIPFSDEI

31.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make sim4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here