Description
Mannosyltransferase involved in outer chain elongation of asparagine-linked oligosaccharides of the type Man(9)GlcNAc(2). Adds the first alpha-1,6-mannose to the Man(8)GlcNAc(2) and Man(9)GlcNAc(2), but not Man(5)GlcNAc(2), endoplasmic reticulum intermediates (By similarity). Represents the first enzymatic event required for synthesis of outer chain mannose linkages on yeast secretory proteins. N-glycan outer chain epitopes play a crucial role in the host-fungal interaction, virulence, and host immune response such as interleukin synthesis or phagocytosis by neutrophils.
Family
Belongs to the glycosyltransferase 32 family.
Species
Candida albicans (strain SC5314 / ATCC MYA-2876)
Sequence
MLQLREPQMVHKHLKLAVLGIVVIFTTYFIISSLSSPTSTHKTEYNSPKLQLAKELELNSNWKELGLNFQPNKKYSLPDESTLRQQLSYQFPYDESKPFPKNIWQTWKVGIDEKSFPKRYLKYQQTWEDKNPDYKHYVVPDKQCDLLIEQLYSQVPDVAKAYRIMPKSILKADFFRYLILFARGGVYTDIDTVGLKPVDEWISNSEMILEKKNRSGLVVGIEADPDRPDWADWYARRIQFCQWTIQSKRGHPMLRELIAKITDITLTRHKKGQLKKVLGKNEGGDIMNWTGPGIFTDTVFEYMNNILQSPEVFKNKKKWATIIDWKLFTGMEQPIAIDDVLVLPITSFSPDVNQMGAKDSHDPMAYAKHMFSGSWKDDGMPEMEQ
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service