Involved in sporulation and maintenance of the mitochondrial DNA. Is probably involved in a pathway contributing to genomic integrity (By similarity).

Belongs to the IRC19 family.

230 amino acids

MRKPSITITTAKAIITPDYTLIKSHSKYQLPSRFQKLDADSPERSTVVKLFYRRFMRLKPFISNVKMVKDTYRDYVRYKFMKENYELKRYLVFNPDGLRSKIKLELLSNTKCCERILPVTEMQRTLEFVLKSCSYLPETKVQKWDIARDNTYCRQILKNLLTMQYEKYRSILHRGIGHDELDVKFSHLKTTSSPLTKLNKTEKKKIPLFKVFSDFDTTLIYLNETLGTRL

27.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make IRC19 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here