Description
Import of proteins with classical NLS composed of one or two clusters of basic residues is initiated by binding to the importin alpha/beta heterodimer, where importin alpha acts as an adapter subunit to bridge NLS cargos to importin beta, which transports the whole complex through the nuclear envelope (PubMed:12684370). Involved in the nuclear accumulation of the light-dependent developmental regulator veA (PubMed:17163983, PubMed:19318129). Participates at different regulatory stages of asexual and sexual development, being required for the completion of both reproductive cycles with the formation of conidiospores and ascospores, respectively (PubMed:19318129). Mediates secondary metabolite gene expression with positive regulation of penicillin production and negative regulation of mycotoxin biosynthesis (PubMed:19318129).
Family
Belongs to the importin alpha family.
Species
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Sequence
MAERYIPEHRRTQYKARNQFRPDELRRRREEQQVEIRKQKREENLAKRRGIQTRDGGIGVGGGMAAAESDDEASAIESELNVELPEMVKGVFSDQIEAQIQATTKFRKLLSKERNPPIERVIETGVVSRFVEFLRSPHTLVQFEAAWALTNIASGSAQQTQVVIEAGAVPIFVELLSSPEPDVREQAVWALGNIAGDSPQCRDFVLNAGALRPLLTLINDGRKISMLRNATWTLSNFCRGKTPQPDWNTIAPALPVLAKLIYMLDDEVLIDACWAISYLSDGPNEKIQAVIEAGIPRRLVELLMHASTSVQTPALRSVGNIVTGDDVQTQVIINCGALPALLSLLSSTKDGIRKEACWTISNITAGNSSQIQSVIDAGIIPPLVHLLANGDFKTRKEACWAISNATSGGLQKPDQIRYLVTQGCIKPLCDLLACPDNKIIQVALDGLENILKVGEMDKEAGQGDAHVNRYALFIEEAGGMEKIHDCQNNANEEIYMKAYNIIEKYFSDEDEAAGDIDELAPQQTQTGFTLGATQQQPGGFSFGGANGGDSMDM
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service