Protein expression services for oig-1 | Immunoglobulin domain-containing protein oig-1
Description
Plays a role in neural development, where it temporally regulates synapse formation in the D-type inhibitory GABAergic motor neurons, dorsal D (DD) and ventral D (VD) motor neurons (PubMed:26387713, PubMed:26083757). Controls the translocation of postsynaptic proteins, such as the acetylcholine receptor subunit acr-12, and presynaptic proteins, such as snb-1, along nerve cords to prevent premature synapse remodeling/formation (PubMed:26387713).
Species
Caenorhabditis elegans
Length
137 amino acids
Sequence
MFSELRILRDILLLCFLSVGINAKSSHIEDLDFTDHTNGSPKISRSSYFKQDFRLGYKLKLFCESSGNPRPQIVWYHRGVEVNPDHNRTIRFSIHGDTVSSHLEVDPTSIGDKGEYECVATNLKGSRVKKFLTDYQY
Mass
15.7 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make oig-1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here