Putative immunity protein component of a toxin-immunity protein module, which may function as a cellular contact-dependent growth inhibition (CDI) system. Blocks the toxic effects of expression of the C-terminus (residues 1519-1658) of cognate toxin RhsC in E.coli.

140 amino acids

MTFQTLSSENNELLTIASESFLKRWAFSEQRLTVDLMTSDDDELTVYIETDLVQSSPIYLNEDLNICRLSIQDMHEILAVQHGYYVPPSRFGDLMKYSSECYSFFYGRKSDFKYLASFIGYEKYIACPIRFLEDISWRIR

16.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rhsIC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here