Description
Possesses hydroxyproline O-galactosyltransferase activity. Transfers galactose from UDP-galactose to hydroxyproline residues in the arabinogalactan proteins (AGPs). Is specific for AGPs containing non-contiguous peptidyl hydroxyproline residues. Utilizes UDP-galactose solely as sugar donor. The addition of galactose onto the peptidyl hydroxyproline residues in AGP core proteins represents the first committed step in arabinogalactan polysaccharide addition. AGP glycans play essential roles in both vegetative and reproductive plant growth.
Family
Belongs to the glycosyltransferase 31 family.
Species
Arabidopsis thaliana
Sequence
MKKPKLSKVEKIDKIDLFSSLWKQRSVRVIMAIGFLYLVIVSVEIPLVFKSWSSSSVPLDALSRLEKLNNEQEPQVEIIPNPPLEPVSYPVSNPTIVTRTDLVQNKVREHHRGVLSSLRFDSETFDPSSKDGSVELHKSAKEAWQLGRKLWKELESGRLEKLVEKPEKNKPDSCPHSVSLTGSEFMNRENKLMELPCGLTLGSHITLVGRPRKAHPKEGDWSKLVSQFVIELQGLKTVEGEDPPRILHFNPRLKGDWSKKPVIEQNSCYRMQWGPAQRCEGWKSRDDEETVDSHVKCEKWIRDDDNYSEGSRARWWLNRLIGRRKRVKVEWPFPFVEEKLFVLTLSAGLEGYHINVDGKHVTSFPYRTGFTLEDATGLTVNGDIDVHSVFVASLPTSHPSFAPQRHLELSKRWQAPVVPDGPVEIFIGILSAGNHFSERMAVRKSWMQHVLITSAKVVARFFVALHGRKEVNVELKKEAEYFGDIVLVPYMDSYDLVVLKTVAICEHGALAFSAKYIMKCDDDTFVKLGAVINEVKKVPEGRSLYIGNMNYYHKPLRGGKWAVTYEEWPEEDYPPYANGPGYVLSSDIARFIVDKFERHKLRLFKMEDVSVGMWVEHFKNTTNPVDYRHSLRFCQFGCVENYYTAHYQSPRQMICLWDKLLRQNKPECCNMR
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service