About Products Protein Database Contact

Protein expression services for GALT5 | Hydroxyproline O-galactosyltransferase GALT5

Description
Possesses hydroxyproline O-galactosyltransferase activity. Transfers galactose from UDP-galactose to hydroxyproline residues in the arabinogalactan proteins (AGPs). Is specific for AGPs containing non-contiguous peptidyl hydroxyproline residues. Utilizes UDP-galactose solely as sugar donor. The addition of galactose onto the peptidyl hydroxyproline residues in AGP core proteins represents the first committed step in arabinogalactan polysaccharide addition. AGP glycans play essential roles in both vegetative and reproductive plant growth.
Family
Belongs to the glycosyltransferase 31 family.
Species
Arabidopsis thaliana
Length
672 amino acids
Sequence
MKKPKLSKVEKIDKIDLFSSLWKQRSVRVIMAIGFLYLVIVSVEIPLVFKSWSSSSVPLDALSRLEKLNNEQEPQVEIIPNPPLEPVSYPVSNPTIVTRTDLVQNKVREHHRGVLSSLRFDSETFDPSSKDGSVELHKSAKEAWQLGRKLWKELESGRLEKLVEKPEKNKPDSCPHSVSLTGSEFMNRENKLMELPCGLTLGSHITLVGRPRKAHPKEGDWSKLVSQFVIELQGLKTVEGEDPPRILHFNPRLKGDWSKKPVIEQNSCYRMQWGPAQRCEGWKSRDDEETVDSHVKCEKWIRDDDNYSEGSRARWWLNRLIGRRKRVKVEWPFPFVEEKLFVLTLSAGLEGYHINVDGKHVTSFPYRTGFTLEDATGLTVNGDIDVHSVFVASLPTSHPSFAPQRHLELSKRWQAPVVPDGPVEIFIGILSAGNHFSERMAVRKSWMQHVLITSAKVVARFFVALHGRKEVNVELKKEAEYFGDIVLVPYMDSYDLVVLKTVAICEHGALAFSAKYIMKCDDDTFVKLGAVINEVKKVPEGRSLYIGNMNYYHKPLRGGKWAVTYEEWPEEDYPPYANGPGYVLSSDIARFIVDKFERHKLRLFKMEDVSVGMWVEHFKNTTNPVDYRHSLRFCQFGCVENYYTAHYQSPRQMICLWDKLLRQNKPECCNMR
Mass
77.3 kDa
Simulated SDS-PAGE
Western blot of GALT5 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make GALT5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here