Hydroperoxy fatty acid reductase essential for the removal of lipid hydroperoxides under normal and stress conditions, leading to the protection of membrane integrity.

Belongs to the glutathione peroxidase family.

154 amino acids

MPLPTSLTTLDGTPLAPEVIADKVVLFVNVASKCGLTPQYSGLVALDKAYGEKGLVIIGVPCNQFGAQEPGSPEEIKDFTKTKYDVDFTLLEKQDVNGPNRSPLYQFLVGDGEDISWNFGKFLIGRDGQVVARFDPQTKPDDTNLKAAIEKALG

16.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gpx2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here