Component of nuclear connecting fibers associated with the transport of ribonucleoprotein particles from either the chromosome to the nuclear pore complex or their transient retention in the nucleoplasm.

535 amino acids

MDVKAEAPNGPAPVKNENQNQPKPQRENMNMNKNQNQNQNNNMGGGGGPNKRNNMNMNKNFQNRGGKGGPGMGPRGPMKNEDFIVNSKLKNLAGPTHDLPELVCEEIKFSGRNRLYIGNLTSDVTEEELKELFSPYGEISEAFINAEKNFAFLKIDYRANAERAKKDLDGRMRKNKPIRIRFAPNATTIRVKNLTPFVSNELLFKSFEVFGQVERAVIIVDDRGKTTGEGIVEFARKSGAMSALKYCSEKCYFLTSSLRPCVVETFDHIDETDGFPEKSLMRKSNDYYKARQNGPRFAEMGSFEHEFGTKWKQMYDMYKQKHDALKREMQLEEEKLEAQMEYAKFEHETESLREQLRKREQDRDRQKKEWEDRERQADESRIRDEQQMRRQQDDMQMRMQRQDEEMRRRQQENSLFMQAQQLSNMLDQQEMNHQGGGGGGGNGGNGNNQGGGGNQGGGRRNYNNDRNNDRNQNFDMMNQGGGNHGGNQYQGNQHYQGNQDQGNRFDGPPQRGNVRPWNNNDRGHRDDFQNKRRRY

61.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make HRP65 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here