Acts as a membranotoxin, probably through its antibacterial and antifungal activities, contributing to the defense mechanism of the plant against predators. Forms monovalent cation-selective ion channels in membranes (By similarity). Contributes to grain texture and hardness.

147 amino acids

MKTLFLLAILALVASTTFAQYSVGGGYNDVGGGGGSQQCPQERPNLGSCKDYVMERCFTMKDFPLTWPTKWWKGGCEQEVREKCCQQLSQIAPQCRCDAIRGVIQGKLGGIFGIGGGDVFKQIQRAQILPSKCNMGADCKFPSGYYW

16.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make HINB-1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here