Essential for Wnt/beta-catenin-mediated formation of the Spemann organizer and for induction of the organizer precursor, the Nieuwkoop center. Acts as a transcriptional activator, cooperating with TGFbeta signals to induce a program of organizer-specific gene expression and to generate an organizer with both head- and trunk-inducing activity. Activates the head organizer gene cer1 by acting synergistically with otx2 and mix-A/mix.1 through the 5'-TAATCT-3' element of the cer1 promoter. Also binds as a complex with lhx1/lim1 and mix-A/mix.1 to the 3x 5'-TAAT-3' element of the cer1 promoter. Required for subsequent dorsoventral axis formation in the embryo, dorsalizing ventral mesoderm and cooperating with t/bra to induce dorsal mesoderm. Also involved in neural induction, inducing the cement gland and neural tissue in overlying ectoderm. Later in development, has the second function of indirectly repressing ventral genes, probably by activating the expression of a transcriptional repressor (By similarity).

240 amino acids

MTCEAEMEQIVSTALTLQEDYIKFTPRNPTMACHTEIIGVFHDIHPTVEKNKEAHRDKLVLQETLVELYSVLGIPQEPQVGKTMKFEEPEQHRGSARFDPLVNSLQLKRPLYEEERRECKRPLVQADEAVAAPSARSRRRTIYSKEQTHFLQNQFDLNPYPDFVNRCRIAKITAIPEPRIQVWFQNRRARHLPRAATSLSPQERKPPGSVGPRSSLCREAQHPEAWSEVLIPSDSQPHPN

27.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make siamois using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here