Protein expression services for mab-5 | Homeobox protein mab-5
Description
Transcription factor that binds to the promoter region of the transcription factor lin-39 to repress its expression in Q neuroblasts and thereby direct left Q neuroblast (QL) daughter cell migration (PubMed:8898225, PubMed:23784779). During postembryonic development, required for posterior-specific pattern formation (PubMed:2903796). Within the posterior body region, controls epidermal, neuronal, and mesodermal cell differentiation (PubMed:2903796, PubMed:21307099).
Family
Belongs to the Antp homeobox family.
Species
Caenorhabditis elegans
Length
200 amino acids
Sequence
MSMYPGWTGDDSYWAGAGTTASSQSASSGTSASASSSAAAAAAANNLKTYELYNHTYMNNMKHMLAAGWMDNSSNPFAYNPLQATSANFGETRTSMPAISQPVFPWMKMGGAKGGESKRTRQTYSRSQTLELEKEFHYHKYLTRKRRQEISETLHLTERQVKIWFQNRRMKHKKEAKGEGGSNESDEESNQDEQNEQHSS
Mass
22.4 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make mab-5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here