Transcriptional regulator which plays a role in the expulsion step of defecation by controlling enteric muscle-specific expression of exp-1 which is required for enteric muscle contraction. Not required for exp-1 expression in the PDA neuron. Also involved in controlling the length of the defecation cycle.

310 amino acids

MNPHTNLNNVFDFPDLPMLLPKSEALSVTTDFSVPPVQQGAQQFHPPRNLGPQLARRWSCGDSQHADEPPASYYHNLGVALHNHFQMSNQHYLSDFDCPTTVSPISSAHETGQLPQLSPYDHIGNQDPHMFSPHAYGNSMIPDNSYFENASRSISAPNVGNSTLNPSLMSSDNAQSCGGRRRFRTNFTELQSTFLEDSFKESHYPDHKAKKYMADFLKIPEDRITVWFQNRRAKWRRKEHRQRDRTRNESFSGGSNSFDFACFSAQHPDDGPNAKHPNSFGIPNQPMSLDQFPMNTEQDFPEFPSLQEHQ

35.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make dsc-1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here