Required for segmental identity of the second through eighth abdominal segments. Once a pattern of abdA expression is turned on in a given parasegment, it remains on the more posterior parasegment, so that the complex pattern of expression is built up in the successive parasegments. The abdA product appears to repress expression of Ubx whenever they appear in the same cell, but abdA is repressed by AbdB only in the eight and ninth abdominal segments.

Belongs to the Antp homeobox family.

single

139 amino acids

PNGCPRRRGRQTYTRYQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARKDREEQEHKIRSSSSDDGSIGKGVGIPLDASLLKSNDSQSVSLNHLTHKSPDGMMDKTPKSII

16.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ABDA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here