May play a central role in the initial events of axis formation and in particular in specifying anterior head regions and their spatial relationship with trunk structures. Activates the head organizer gene cer1 by acting synergistically with siamois and mix-A/mix.1 through the 5'-TAATCT-3' element of the cer1 promoter. Also binds as a complex with lhx1/lim1 and ldb1 to the gsc promoter to stimulate expression.

Belongs to the paired homeobox family. Bicoid subfamily.

288 amino acids

MMSYLKQPPYAVNGLSLTASGMDLLHQSVGYPATPRKQRRERTTFTRAQLDILEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPSKKKTSPVREVSSESGTSGQFSPPSSTSVPVISSSTAPVSIWSPASVSPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLSPMHHQLSGPGATLSPMGTNAVTSHLNQSPVALSSQAYGASSLGFNSTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL

31.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make otx2-a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here