Transcription factor which is involved with the serum response factor (SRF) in the smooth muscle cell-specific transcription of the beta-tropomyosin gene in the upper digestive organs and their attached arteries.

Belongs to the BAR homeobox family.

247 amino acids

MQHPLELGAAHYFPAEAFPDHRSHRYRSFMIEEILTDPPDAKGTAPPGELLKFGVQALLSARPYHSHLAVLKAEPAAVFKFPLAPLGCSGLGSALLAAGSGLQGGSASPHLPLELHLRGKLEPGGPETGSKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPSSEQLSEQERARDAEKPPESLGSPAEVSQEE

27 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make BARX1B using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here