About Products Protein Database Contact

Protein expression services for PR-Set7 | Histone-lysine N-methyltransferase PR-Set7

Description
Histone methyltransferase that specifically monomethylates 'Lys-20' of histone H4. H4 'Lys-20' monomethylation is enriched during mitosis and represents a specific tag for epigenetic transcriptional repression. Mainly functions in euchromatin regions, thereby playing a central role in the silencing of euchromatic genes. Required for cell proliferation, possibly by contributing to the maintenance of proper higher-order structure of DNA and chromosome condensation during mitosis.
Family
Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. PR/SET subfamily.
Species
Drosophila melanogaster
Length
691 amino acids
Sequence
MIMVRRRQRPAKEAASSSSGGASSGSGIPVDQALPLNVAGNLLEDQYFASPKRKDCRLMKVTQNGQLPEATMMAHNKDNKAGRTIGVPLATRSQTRTIENFFKANAAAKDSQKTIHTEEQLNLGNQELKLDDEELNGQIKLDDEVLKLADKQINENLPFADEVDAKAEQKLMDEELQQVVEELLFDGSSRASSNSPFYQHDMDVMQEIQQTPEIPHIKKVTEPLEGLGSLADFQTHRSALRDSHSSTHSSSTDNIFLQEPVLTLDIDRTPTKASSIKINRSFELAGAVFSSPPSVLNACLNGRFNQIVSLNGQKEALDLPHFDLDQHDSSSCDSGVACGLTANTESPAGQPRRRKPATPHRILCPSPIKTALKVTGGICKVGSADPLSPRKSPRKLPTTTAAVAACKSRRRLNQPKPQAPYQPQLQKPPSQQQQQQQDDIVVVLDDDDDEGDDEDDVRALIKAAEERENQNKAPATANSNKAGMKTMLKPAPVKSKTKSKGPTKGQPPLPLAATNGNREMTDFFPVRRSVRKTKTAVKEEWMRGLEQAVLEERCDGLQVRHFMGKGRGVVADRPFKRNEFVVEYVGDLISIGEAAEREKRYALDENAGCYMYYFKHKSQQYCIDATVDTGKLGRLINHSRAGNLMTKVVLIKQRPHLVLLAKDDIEPGEELTYDYGDRSKESLLHHPWLAF
Mass
76.5 kDa
Simulated SDS-PAGE
Western blot of PR-Set7 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make PR-Set7 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here