Not known. Encoded in the intron of cAMP-dependent protein kinase regulatory chain type I.

215 amino acids

MSNLKQKDSKPEVAVTKSVKTYKKSIEYVNSDASDIEEDINRAEDEYASSSGFVNFLRDFKKRYGEYYSNNEIRRAAETRWNEMSFRHRCQYSAEPLDTFHVEPNSVSSLQRSSEGEHRMHSEISGCADTFFGAGGSNSCTPRKENKCSKPRVRKSCPKPRAKTSKQRRSCGKPKPKGARPRKACPRPRKKMECGKAKAKPRCLKPKSSKPKCSM

24.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Mst77F using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here