Histones H3 and H4 chaperone involved in the nucleosome formation and heterochromatin silencing. Required for the deposition of H3K56ac-carrying H3-H4 complex onto newly-replicated DNA. Plays a role in the transcriptional regulation of the cell-cycle dependent histone genes by creating a repressive structure at the core histone gene promoter (By similarity).

Belongs to the RTT106 family.

469 amino acids

MAAKLDSQLLGLVFQSRPDILKGIQEAADSPARIDLFNNIASFVYERIADNTSEEPATKRRRVEAQTSGPNGAAHPIAGSQAAVLGADAAAAEPVLLEIKDISVSVPQRKKYDLCFTKNFLYARASGSPVPVQGIVYPWKDIEHAFYLPVPDKSQVQHNYVLLPRNSYLPTTKSQQSADQQTQQQTSAPLEPLVFTIPSTAPKPGTITGPSAAAAAPVSDSYATLFHWALTTSLHAAGNHACELVSSDPKVFHSVARQAYRPQEKAVHVKAFRGSKDGFLFFLPTGILWGFKKPLLFLPLDKIVAISYTSVLQRTFNIVVELEGGGEGSEEGGQEIEFSMLDQEDYAGIDQSYVRRHGLADRSMAEQRKAKKQLAENAKKAAANGEEGEGGEGGEAGDGLTELERAQKEEEQRLQDEEDEEEEDYDPGSEGESEGSGSSSEEEEEEEDGEGEGDEDDDEDMGEGLEGEE

50.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rtt-106 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here