Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly.

Belongs to the ASF1 family.

200 amino acids

MAKVQILNMVVLDNPCPFHNPFQFEITFECIEDLPDDLEWKIIYVGSAESEEYDQTLDSVLVGPVPAGRHMFVFQADAPNCSLIPESDAVGVTVVLITCTYRGQEFIRVGYYVNNEYSDPELRENPPLKAHFGQLQRNILASNPRVTRFHINWECTSEAKMEDIENVDPASNTMLPPNCAPSKGLAAALNTLPENSMDCM

22.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make asf1ab using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here