Description
Catalytic component of the NuA4 histone acetyltransferase (HAT) complex which is involved in epigenetic transcriptional activation of selected genes principally by acetylation of nucleosomal histones H4, H3, H2B, H2A and H2A variant H2A.Z. Acetylates histone H4 to form H4K5ac, H4K8ac, H4K12ac and H4K16ac, histone H3 to form H3K14ac, histone H2B to form H2BK16ac, and histone H2A to form H2AK4ac and H2AK7ac. Acetylation of histone H4 is essential for DNA double-strand break repair through homologous recombination. Involved in cell cycle progression. Recruitment to promoters depends on H3K4me.
Family
Belongs to the MYST (SAS/MOZ) family.
Species
Yarrowia lipolytica (strain CLIB 122 / E 150)
Sequence
MALAEADLPNGKTNGKASGSEETPAPVQKVDMNVAINELRVGCKVHVEKDGEDRVAEILSVQMRRGNLEFYVHYVEFNKRLDERIAATRVDLSQGVIWPEPEKPKKPLSGAAKESSKEKKKNPSKKQKLTDSAATTPGANSEDVMDLDNLQVNGTTQDPDNFNRDEEIEKLRTGGSMTQSSHEVARVRNLQRIVLGNHVIEPWYFSPYPIELTEEDEIYICDFTLCYFGSKKQFERFRSKSTLRHPPGNEIYRDEAVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDEKGHHLVGYFSKEKESAEGYNVACILTLPQYQRHGYGRLLIDFSYALSKAEGKTGSPEKPLSDLGLLSYRAYWADTIIELLMEKGKQEMTIEDIASVTAMTTTDVLHTLQTYNMLKYYKGQHIICLTDSVCEKYEKMLKKRRRKVNSELLKWKPPVFTAAQLRFAW
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service