About Products Protein Database Contact

Protein expression services for CSE4 | Histone H3-like centromeric protein CSE4

Description
Histone H3-like variant which exclusively replaces conventional H3 in the nucleosome core of centromeric chromatin at the inner plate of the kinetochore. Required for recruitment and assembly of kinetochore proteins, mitotic progression and chromosome segregation. May serve as an epigenetic mark that propagates centromere identity through replication and cell division (By similarity).
Family
Belongs to the histone H3 family.
Species
Yarrowia lipolytica (strain CLIB 122 / E 150)
Length
150 amino acids
Sequence
MARISLASSSAGVAGKPRGGGGLHPLGQTRKTLPGERRDTTQKITKPRYKPGQKALKEIRRYQRGTELLIAKLPFARVVREVALNYLGSEYGNLQWQSMALLALQEAAEAFLVHLFEDVNLCAIHAKRVTIMQKDMQLARRIRGAWGGAG
Mass
16.6 kDa
Simulated SDS-PAGE
Western blot of CSE4 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make CSE4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here