Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Belongs to the histone H2B family.

131 amino acids

MAPKAEKKPASKAPAEKKPAAKKTASSTDGGKKRTKARKETYSSYIYKVLKQTHPDTGISQKAMSIMNSFVNDIFERIASEASKLAAYNKKSTISAREVQTAVRLILPGELAKHAVSEGTRAVTKYSSAQN

14.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make HTB1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here