Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures.

Belongs to the histone H1/H5 family.

253 amino acids

MSDVAVAADTTETPAAPTKASKATKASKATKASKATKAKTTKVPMVKADAAHPPFINMVTEAISSIKDRKGPSRAAILKYITTKYTLGDQANKINAHLRKALNKGLESNAFVQASGNGANGRFRLAEKTASVAKSPAAAKKDATGEKKATTTVAKKAATGEKKATTTVAKKAATGEKKATTTVAKKAAAGDKAKKTEVKVKKVKSPKKIAKSPVNKVTKSPVKKIAKSSSMKAAPKKAAAKPAKKAPAAAPEA

26 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make hil-4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here