About Products Protein Database Contact

Try expressing hisN in cell-free | Histidinol-phosphatase

Description
Catalyzes the dephosphorylation of histidinol-phosphate to histidinol, the direct precursor of histidine.
Family
Belongs to the inositol monophosphatase superfamily.
Species
Chlorobaculum parvum (strain NCIB 8327)
Length
259 amino acids
Sequence
MTPDLQLALELAEKAGKLTLDYFGRRSLQVFSKRDDTPVTEADRNAEELIRQGISAKFPDDGLFGEEFDEHPSGNGRRWIIDPIDGTRSFIHGVPLYGVMIALEVEGAMQLGVINFPALGELYQAERGSGAFMNGSPVQVSAIAENSASTVVFTEKEYLLDPPSNHPVDQLRIDAGLVRGWGDCYGHMLVASGRAEVAVDKIMSPWDCAAVIPIVEEAGGCCFDYRGRQSIIDGEGLVSANNAMGRNLIAAIGNGERDR
Mass
28.1 kDa
Simulated SDS-PAGE
Western blot of hisN recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Cell-Free protein synthesis
Have you tried producing hisN in a cell-free protein expression systems? We have solved cell-free protein expression scale-up and purification challenges so that you can obtain up to low-milligram quantities of proteins in hours.

Order Here