Catalyzes the dephosphorylation of histidinol-phosphate to histidinol, the direct precursor of histidine.

Belongs to the inositol monophosphatase superfamily.

260 amino acids

MSHDDLMLALALADRADELTRVRFGALDLRIDTKPDLTPVTDADRAVESDVRQTLGRDRPGDGVLGEEFGGSTTFTGRQWIVDPIDGTKNFVRGVPVWASLIALLEDGVPSVGVVSAPALQRRWWAARGRGAFASVDGARPHRLSVSSVAELHSASLSFSSLSGWARPGLRERFIGLTDTVWRVRAYGDFLSYCLVAEGAVDIAAEPQVSVWDLAALDIVVREAGGRLTSLDGVAGPHGGSAVATNGLLHDEVLTRLNAG

27.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Have you tried producing hisN in a cell-free protein expression systems? We have solved cell-free protein expression scale-up and purification challenges so that you can obtain up to low-milligram quantities of proteins in hours.

Order Here