About Products Protein Database Contact

Protein expression services for AHP1 | Histidine-containing phosphotransfer protein 1

Description
Functions as two-component phosphorelay mediators between cytokinin sensor histidine kinases and response regulators (B-type ARRs). Plays an important role in propagating cytokinin signal transduction through the multistep His-to-Asp phosphorelay (By similarity). Functions as positive regulator of the cytokinin signaling pathway. May play a regulatory role in salt and drought tolerance during plant development (PubMed:24578505).
Species
Oryza sativa subsp. japonica
Length
147 amino acids
Sequence
MAAAALTSQLNALVNNMFAMGLLDDQFQQLQMLQDSTAPDFVSEVVTLFCDDGERIICELSRQLEKPNVDFDRVDSYVHQLKGSSASVGAQKVKNTCIQFREFCQQRSRDGCLKTLDLVRTEFYDLRNKFQAMLQLEQQIQACYPKH
Mass
16.8 kDa
Simulated SDS-PAGE
Western blot of AHP1 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make AHP1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here