Has hexosaminidase activity (PubMed:19040401). Responsible for the cleavage of the monosaccharides N-acetylglucosamine (GlcNAc) and N-acetylgalactosamine (GalNAc) from cellular substrates. Has a preference for galactosaminide over glucosaminide substrates (By similarity).

Belongs to the glycosyl hydrolase 20 family.

486 amino acids

MSSPTPFKMRLVHLDLKGAPPKVSYLSEVFPLFHALGANGLLIEYEDMFPYEGHLRLLRAKHAYSPSEVTEILRLARLSELEVIPLVQTFGHMEFVLKHAAFAHLREVALFPNTLNPHEAESLALVQAMIDQILELHRDVRWLHIGCDEVYYLGEGETSKQWLQQEQNSHAKLCLSHMQAVASHVLTQHPGVTPLVWDDMLRDIPQEQLKASGVPQLVEPVLWDYGADLDVHGKVFLIGKYQECGFQRLWAASAFKGATGASQALPPVEHHIRNHELWLQVAGSGPKDALQGIILTGWQRYDHFSVLCELLPVGIPSLAACLQSLVHGGFAEDVRLRAERFLGVSSLEIADTVSEGAGSFPGSDIHALVTQISLHLRSSVDTLLERNRYVTGWFSPYHRRRKLVHPVMIQHIQPEALSLLSRWNNLVQQLEVALQPVFYPDTIEEWLEENVLPSLQRLQDLLQDLGEAAARQPPPTSPGWDTGQNP

54.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Hexd using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here