Catalyzes consecutive E-type condensation of two isopentenyl pyrophosphate (IPP) molecules with an allylic substrate such as geranylgeranyl diphosphate (GGPP), farnesyl diphosphate (FPP) or geranyl diphosphate (GPP) to yield the medium-chain product trans-C30-hexaprenyl pyrophosphate (HexPP). GGPP is the physiological substrate.

Belongs to the FPP/GGPP synthase family.

281 amino acids

MSIIEFWLEAKATIDRLIEQFLNSNRDWDLVDISSYILKDGKRFRGTLNMFFTVALGGDIKDSYGGALAIEILHSASLALDDIVDLDATRRGDKAAWVVYGNRKVIFITNYLIPTALRIIQTSYGDDALNTSIELWKDTSVGALRDMYDNSDYIRTIELKTGSLFKLSTVLSAYASKHYNTKQQMLDVGKYLGIIYQVIDDFVDYKTKKVEEIDGSAKQLFKYYREGKLEEYVRSVYLEYKQKYDELISNIPFQSKYLSEIRSLPEFLANGLLKEANIDKI

32.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gdS-2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here