Seems to act as a signaling molecule involved in the maintenance of iron homeostasis. Seems to be required in conjunction with HFE to regulate both intestinal iron absorption and iron storage in macrophages. May also have antimicrobial activity (By similarity).

Belongs to the hepcidin family.

91 amino acids

MKLSNVFLAAVVILTCVCVFQITAVPFIQQVQDEHHVESEELQENQHLTEAEHRLTDPLVLFRTKRQSHLSLCRFCCKCCRNKGCGYCCKF

10.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make hamp2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here