Regulates the proliferation and differentiation of hematopoietic cells. Overexpression block the TPA-induced megakaryocytic differentiation in the K562 cell model. May also prevent cell apoptosis through the activation of the nuclear factor-kappa B (NF-kB) (By similarity).

514 amino acids

MDVRKDQSHLTLNQTPEAHVEKSHAPDIIGSWSLRNREQLKKRKAEAQGRQTSQWQLGEQKKRKYQRTGKGNRRGRKRQGNVEQKAESWSQTENERVQEVLVPAEEETEYSGNTATQALPLRASPTKAVPTEHCSEVPQESLQCQEITIQNHSQTHQRRDKAEALSPTTCQEIGVLQYSPKMCQDMAEPEARSPKMCQETAVPQTYSPKAHEDMAEYEALSPKMCRETPVPQYHSSKIPQDMTGPEALAPDMCQETTVSQNHSSKVPQDMAGPEALSLKMCQEPTVLQEHTLKICQDVARPDVLSSKTHQEMTVPKALPCITPGDAAGPEGCSPKTLPQSDVTPMSVTPGKNTSHPDLGTAVAEGCFSEAGECIVSEDISTKTHQEAVEPKFLSHKTYKEFTVPIVSSHKTIQESPGPEEYSPGSRHEMSGPEDLSIKTCKNRDGPKHSLPEGAQEVGGAQRQDPDAQDIEDAGAFSQDLEEGNKADQDPETPAGPQGPQKICPENDVHSSALF

56.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Hemgn using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here