Protein expression services for Rv3405c | HTH-type transcriptional repressor Rv3405c
Description
Negatively regulates the expression of sulfate ester dioxygenase Rv3406 and its own expression (PubMed:25427196, PubMed:29395080). Binds specifically to the inverted repeat sequence of the intergenic region between Rv3405c and Rv3406 (PubMed:29395080).
Species
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Length
188 amino acids
Sequence
MTTRPATDRRKMPTGREEVAAAILQAATDLFAERGPAATSIRDIAARSKVNHGLVFRHFGTKDQLVGAVLDHLGTKLTRLLHSEAPADIIERALDRHGRVLARALLDGYPVGQLQQRFPNVAELLDAVRPRYDSDLGARLAVAHALALQFGWRLFAPMLRSATGIDELTGDELRLSVNDAVARILEPH
Mass
20.6 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Rv3405c using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here