Protects cells from HOCl (hypochlorite) stress but not peroxide or diamide stress. Decreases the intracellular load of reactive oxygen species by up-regulating genes involved in methionine and cysteine biosynthesis and down-regulating Fur-regulated genes involved in iron acquisition. Has also been suggested to down-regulate expression of the flagellar regulon, decreasing motility, but this activity was not confirmed in a second study (PubMed:22223481).

Belongs to the LysR transcriptional regulatory family.

303 amino acids

MDDCGAILHNIETKWLYDFLTLEKCRNFSQAAVSRNVSQPAFSRRIRALEQAIGVELFNRQVTPLQLSEQGKIFHSQIRHLLQQLESNLAELRGGSDYAQRKIKIAAAHSLSLGLLPSIISQMPPLFTWAIEAIDVDEAVDKLREGQSDCIFSFHDEDLLEAPFDHIRLFESQLFPVCASDEHGEALFNLAQPHFPLLNYSRNSYMGRLINRTLTRHSELSFSTFFVSSMSELLKQVALDGCGIAWLPEYAIQQEIRSGKLVVLNRDELVIPIQAYAYRMNTRMNPVAERFWRELRELEIVLS

34.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make yjiE using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here