Transcription regulator that actives the transcription of genes required for nitrogen assimilation during nitrogen limitation. On the contrary of the MerR members, which require longer DNA sites for high-affinity binding, TnrA requires a DNA sequence of 17 nucleotides as minimal binding site.

108 amino acids

MSTNEASYRDKKVMSIGIVKELTGLSERQIRYYEKRSLLFPDRTNTGIRKYSFSDVERLMDIADRIEEGVQTSEIRTELAKKDEARKMKEVKNQMLQGQLNAHFKRKL

12.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make tnrA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here