Central regulator of manganese homeostasis that regulates the expression of both manganese uptake and efflux systems (PubMed:27748968, PubMed:10760146, PubMed:12950915). In the presence of high levels of manganese, it mediates repression of the manganese uptake systems MntH and MntABCD and activation of the efflux systems MneP and MneS. Binds with high affinity to the regulatory regions of its target genes (PubMed:27748968, PubMed:12950915). The manganese concentration required for activation of efflux is higher than that for repression of uptake (PubMed:27748968).

Belongs to the DtxR/MntR family.

142 amino acids

MTTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKKTEHHNQ

16.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mntR using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here